DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Rom1

DIOPT Version :10

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_033099.3 Gene:Rom1 / 19881 MGIID:97998 Length:351 Species:Mus musculus


Alignment Length:241 Identity:60/241 - (24%)
Similarity:92/241 - (38%) Gaps:63/241 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GISMVKYILFI---FNLLCSICGILLIVFGAL-LFSKVRNMDDFAEALRTQQVPVTMIILGTIIL 64
            ||.::.::|.:   ..||||  |.||:..|.| .|        .|.:.....:|.|.:..|| :.
Mouse    20 GIWLLSWLLALVGGLTLLCS--GHLLVQLGHLGTF--------LAPSCSFPALPQTALAAGT-VA 73

  Fly    65 LISWFGCCGAIRESYCMSMTY----SILLFVLMIG----------QLALVIYMWVQKDKYLEIMG 115
            |.:..|..||.|.|...:. |    .:|..:|.:|          .|.|.:.:.|..::.||   
Mouse    74 LGTGLGGAGASRASLDAAQ-YPPWRGVLTPLLAVGTAAGGGLLTLALGLALALPVSLNQGLE--- 134

  Fly   116 DVVEKAWNH--------RTSRSDYMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETV 172
            :.:|.|..|        |......||.:|:...||||.||.|:.              ..:|  |
Mouse   135 EGLEAALAHYKDTEVPGRCQAKRLMDELQLRYHCCGRHGYKDWF--------------GVQW--V 183

  Fly   173 YRRGCKVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIR 218
            ..|....:..:..||....::  ||.:    ..|..|:||..:|.|
Mouse   184 SNRYLDPSDQDVVDRIQSNVE--GLYL----IDGVPFSCCNPHSPR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspanin 8..215 CDD:459767 56/232 (24%)
Rom1NP_033099.3 peripherin_like_LEL 128..264 CDD:239415 29/121 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..351
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.