DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and tsp-13

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_741692.1 Gene:tsp-13 / 189737 WormBaseID:WBGene00006639 Length:321 Species:Caenorhabditis elegans


Alignment Length:223 Identity:58/223 - (26%)
Similarity:106/223 - (47%) Gaps:25/223 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGISMVKYILFIFNLLCSICGILLIVFGALL--FSKVRN----------MDDFAEALRTQQVPVT 55
            ||: ..||.:|..|::..|.|.||:..|..|  .|:.||          .:.|.||.........
 Worm    53 CGV-WAKYGIFTANIVFLIVGGLLLAMGVWLRTDSRFRNFISERYRQAVQEAFWEAPTLFAFSYI 116

  Fly    56 MIILGTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKD----KYLEIMGD 116
            :|:||.::::::..||||....|....:.||:::|:|::..|:..||:..:||    :..:.:..
 Worm   117 IIVLGAVMMVVAMLGCCGITGRSRPFLIIYSMVVFLLLVATLSCGIYLLYKKDGLDVELSDALNY 181

  Fly   117 VVEKAWNHRTSRSDYMDAIQISMKCCGRSGYTDY-AYQGKFPPSCCSDTNNCRWETV--YRRGCK 178
            :|:..:.......:.:|.:|.:.:|||.:|.:|: .::...|.||....:.|.:..:  .|.|..
 Worm   182 MVQHYYQGPGVVQESLDHLQTAFRCCGNAGCSDFRVFRQDIPRSCDIRCDGCHFRIMIALRIGFS 246

  Fly   179 VTFVEFWDRNSDIIKYAGLVIA-AIEFV 205
            ||.:.|    |.::....|.|. |:.||
 Worm   247 VTLIVF----SAVVLCQVLTICFALYFV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 56/218 (26%)
tetraspanin_LEL 104..188 CDD:239401 19/90 (21%)
tsp-13NP_741692.1 Tetraspannin 58..269 CDD:278750 54/214 (25%)
tetraspanin_LEL 165..242 CDD:239401 14/76 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.