DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and tsp-9

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_508232.1 Gene:tsp-9 / 180472 WormBaseID:WBGene00006635 Length:233 Species:Caenorhabditis elegans


Alignment Length:255 Identity:60/255 - (23%)
Similarity:106/255 - (41%) Gaps:52/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALL--FSKVRNMD--------DFA----------- 44
            |.||.|.:|.:.|:.|..  ||     :||||:  ||...|:|        ||.           
 Worm     1 MVCGNSCIKLLFFVINFF--IC-----IFGALICGFSLWANLDKNFGSHLSDFVRQIEGIDQKLV 58

  Fly    45 -EALRTQQVPVTMIILGTIILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKD 108
             |....|.....::.:|.::.|:.:||||||..||..:...:..::.:|...:|...::....::
 Worm    59 NEIAEYQASLWILVAVGALLFLVGFFGCCGAGCESPVLLGLFIFIIVILTAVELGATVFAMTNRE 123

  Fly   109 KYLEIMGDVVEKAWNHRTSRSDY-----MDAIQISMKCCGRSGYTD--YAYQGKFPPSCCSDTNN 166
            :::..:..|::|      |.:.|     :..||...:|||.:..|.  |...|...|...|...|
 Worm   124 EFVSSIQQVLKK------SSATYELRKNIKPIQNVFQCCGATAQTQNRYIQDGLCGPEPLSAPVN 182

  Fly   167 CRWETVYRRGCKVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226
            | ::.:..      .|:.|..:..::.:   ::.|||....:|:|.|..|.:..|....|
 Worm   183 C-FDRISH------MVQSWGESIVVVAF---LLLAIELFAILFSCILCRSSQEIRYTPYY 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 53/237 (22%)
tetraspanin_LEL 104..188 CDD:239401 18/90 (20%)
tsp-9NP_508232.1 Tetraspannin 7..222 CDD:278750 53/237 (22%)
tetraspanin_LEL 116..>167 CDD:243179 10/56 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.