DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Cd63

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus


Alignment Length:240 Identity:67/240 - (27%)
Similarity:124/240 - (51%) Gaps:36/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GISMVKYILFIFNLLCSICGILLIVFGA---LLFSKVRNMDDFAEALRTQQVPVTMIILGTIILL 65
            |:..||::|::..|....|.:.||..|.   ::..:....:..|.:|    :||.:|.:|..:.|
Mouse     6 GMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSL----LPVVIIAVGAFLFL 66

  Fly    66 ISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWN--HRTSR 128
            :::.|||||.:|:||:.:|::|.|.::|:.::|:.|..:|.:|:        |:..:|  .:...
Mouse    67 VAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQ--------VKSEFNKSFQQQM 123

  Fly   129 SDY---------MDAIQISMKCCGRSGYTDY-----AYQGKFPPSCCSDT-----NNCRWETVYR 174
            .:|         :|.:|....|||.|.|||:     ..:.:.|.|||.:.     |:.:..|::.
Mouse   124 QNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHT 188

  Fly   175 RGCKVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRN 219
            :||..|...:..:|..::..|.|.||.:|.:|.:|:|||..|||:
Mouse   189 QGCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSIRS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 63/232 (27%)
tetraspanin_LEL 104..188 CDD:239401 23/104 (22%)
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 61/228 (27%)
CD63_LEL 105..203 CDD:239419 23/105 (22%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.