DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and Tspan9

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001366065.1 Gene:Tspan9 / 109246 MGIID:1924558 Length:330 Species:Mus musculus


Alignment Length:241 Identity:68/241 - (28%)
Similarity:116/241 - (48%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILLISWFGCC 72
            :||.:|:|||:..:||..|:..|..|.....|...|:.:..:......:|.:|||:::..:.||.
Mouse   100 LKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFLGCL 164

  Fly    73 GAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLE-IMGDVVE--------------KAW 122
            |||:|:.|:.:::.|:|.::::.:|.|:|..:|..||..| ...|:.|              .||
Mouse   165 GAIKENKCLLLSFFIVLLIILLAELILIILFFVYMDKVNENAKQDLKEGLLLYNTENNVGLKNAW 229

  Fly   123 NHRTSRSDYMDAIQISMKCCGRSGYTD-YAYQGK--FPPSCC-SDTNNC-RWET--VYRRGCKVT 180
            |          .||..|:|||.:.||| |...|:  .|..|| .::..| |..|  ::|.||...
Mouse   230 N----------IIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNSTTPLWRTGCYEK 284

  Fly   181 FVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226
            ...::|.|..::...|:.|..::.:|..|:..|...|  :|...:|
Mouse   285 VKLWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHI--HRTGKKY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 65/230 (28%)
tetraspanin_LEL 104..188 CDD:239401 30/105 (29%)
Tspan9NP_001366065.1 Tetraspannin 100..317 CDD:395265 64/226 (28%)
NET-5_like_LEL 196..293 CDD:239418 30/106 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.