DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and cd53

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_002942834.1 Gene:cd53 / 100496085 XenbaseID:XB-GENE-868554 Length:228 Species:Xenopus tropicalis


Alignment Length:220 Identity:60/220 - (27%)
Similarity:118/220 - (53%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVT----MIILGTIILL 65
            ::.:||::|.||.|..:.|..:|..|  ::..|.|:  :.:.| |....:|    :|.:|.||::
 Frog     6 VNTLKYLMFAFNFLFWVTGCSIIAIG--IYFVVNNI--YGDLL-TNNPSLTVGNALIAIGIIIMV 65

  Fly    66 ISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWV---QKDKYLEIMGDVVEKAW--NHR 125
            ..:.||.|||:|:.|:.:|:.|||.::::.::.:.|.::|   |.|.|:.   |.:..::  |.:
 Frog    66 FGFLGCMGAIKENKCLLLTFFILLLLILLAEVIMAILLFVYEKQLDNYVR---DRLTSSFEQNLK 127

  Fly   126 TSRSDYMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNN--CRWETVYRRGCKVTFVEFWDRN 188
            .:.|:..:.||.:::|||.:|..|  ::...|.|||:...|  |....:::.||......::::|
 Frog   128 QNSSETWNIIQRNLQCCGINGTKD--WKDNIPNSCCASNANSKCSQADLFKMGCSEALKNWFEKN 190

  Fly   189 SDIIKYAGLVIAAIEFVGFVFACCL 213
            ...:....:.|:.||.:|..||..|
 Frog   191 FLYVGVGTICISVIEVLGMSFALTL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 60/217 (28%)
tetraspanin_LEL 104..188 CDD:239401 22/90 (24%)
cd53XP_002942834.1 Tetraspannin 9..215 CDD:366035 59/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.