DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ea and XB5740125

DIOPT Version :9

Sequence 1:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_002934840.1 Gene:XB5740125 / 100145428 XenbaseID:XB-GENE-5740126 Length:245 Species:Xenopus tropicalis


Alignment Length:221 Identity:53/221 - (23%)
Similarity:101/221 - (45%) Gaps:53/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ILLIVF----GALLFSKVRNMDDFAEALRTQQ---------VPVTMIILGTIILLIS-WFGCCGA 74
            ||.::|    |.||::...|:..:    ::.|         :|..|.:.||..|:|: ..|||.:
 Frog    15 ILALLFWTAAGCLLYAGYYNIKTY----KSYQSFFHDRYILIPSGMAVTGTFFLVINGLLGCCIS 75

  Fly    75 IRESYCMS--MTYSILLFVLMIGQLALVIYMWVQK-DKYLEIMGDVVEKAWNHRTSRSDY-MDAI 135
            .:.|.|..  ..|.:::.:.:....|::.::::.: |..|:.|.:..|   |:..|:||. ::.|
 Frog    76 KKGSRCQQGCFMYFVVIVLCLEASAAVLAFLYMDRMDFELKPMLEAFE---NYDGSKSDVTVNKI 137

  Fly   136 QISMKCCGRSGYTDYA----YQGKF--PPSCCSDT------NNCRWETVYRRGCKVTFVEFWDRN 188
            |..::|||...|||:.    |:..|  |.:||::|      |....:..|:.||       :|:.
 Frog   138 QKELRCCGLHNYTDWEATSWYRQNFTIPKTCCNETYTTCYGNTTESKAFYQEGC-------FDKL 195

  Fly   189 SDIIKYAGLVIAAIEFVGFVFACCLA 214
            ...:.|         |:.::|..|:|
 Frog   196 HHRLNY---------FMTWLFWSCIA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 53/221 (24%)
tetraspanin_LEL 104..188 CDD:239401 27/97 (28%)
XB5740125XP_002934840.1 Tetraspannin 9..222 CDD:366035 53/221 (24%)
tetraspanin_LEL 104..204 CDD:351888 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.