DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and CD63

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:250 Identity:75/250 - (30%)
Similarity:111/250 - (44%) Gaps:54/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVG---SIMLSTMGNFTAFDGGVNTQTIPICIIVIGSV 62
            |.|:    |:|||:|.|.|.|..:.||.||   .::||.    |...|......:|:.||.:|..
Human     7 MKCV----KFLLYVLLLAFCACAVGLIAVGVGAQLVLSQ----TIIQGATPGSLLPVVIIAVGVF 63

  Fly    63 TFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDENNA 127
            .|:|||.||||..:||.|....:||.:.::..:::|.:|..:...||.:|..         .||.
Human    64 LFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEF---------NNNF 119

  Fly   128 AQ---GYP--------MDALQLAFSCCGNTGYQQYETVPS--------SC-------CGYKDRTK 166
            .|   .||        :|.:|..|.|||...|..:|.:||        ||       ||.....|
Human   120 RQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEK 184

  Fly   167 VCEAEIYSQRPGCRQEFVDFWASNTDLIRWSSLIIALFE-LGIFIMSCCLASAMR 220
            ....|      ||.::...:...|..::..::|.||..| ||| :.:|||..::|
Human   185 AIHKE------GCVEKIGGWLRKNVLVVAAAALGIAFVEVLGI-VFACCLVKSIR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 72/240 (30%)
tetraspanin_LEL 104..191 CDD:239401 26/112 (23%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 70/240 (29%)
CD63_LEL 105..203 CDD:239419 26/112 (23%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.