DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp96F

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:264 Identity:65/264 - (24%)
Similarity:100/264 - (37%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICI-IVIGSVTFVV 66
            |.|.: |||:.|:|::|...|:.::|....||:......:.....|...|.:.: :.||.:..:.
  Fly     6 CCSCV-KYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILITLG 69

  Fly    67 AFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDE-----NN 126
            |||||||..||:.|....:...:||:...|:|...|.|...||....:..||..:..|     ..
  Fly    70 AFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTM 134

  Fly   127 AAQGYPMDALQLAFSCCGNTGYQQYET------------------------VPSSCCGYKDRTKV 167
            :::....|.||....|||..|...:.|                        :|.|||  ||..|.
  Fly   135 SSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCC--KDNLKD 197

  Fly   168 CEAE--------------IYSQRPGCRQEFVDFWASNTDLIRW--------SSLIIALFELGIFI 210
            .|.|              ||.|  ||..:.::....|     |        :.:::.|..|...:
  Fly   198 NECELSRRLKFGGPLNNAIYQQ--GCVDKLIEIIYEN-----WVTIFAVTAAVILLELLSLTFAL 255

  Fly   211 MSCC 214
            ..||
  Fly   256 SLCC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 63/259 (24%)
tetraspanin_LEL 104..191 CDD:239401 28/129 (22%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 63/261 (24%)
CD151_like_LEL 107..233 CDD:239408 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.