DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp86D

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:264 Identity:70/264 - (26%)
Similarity:115/264 - (43%) Gaps:69/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQT-------IPICIIVIGS 61
            :|:..||:::|||.:|...|.||:.:|  :.:.|......:|.:...|       |.:.:|:.|.
  Fly    27 VSSCVKYMIFLLNFLFWLFGGLLLAIG--VYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIAGV 89

  Fly    62 VTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFA------------ANDKFLSSM 114
            :.|.|:|.||.|.:|||.....:|::|:|:.|.|:::|:|..|.            ..||.:.| 
  Fly    90 IVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHS- 153

  Fly   115 GKAVDKAWDENNAAQGYPMDALQLAFSCCG--NTGYQQYET---------------VPSSC---- 158
                   :.:::..|.: :|..|..|:|||  |.|||.:..               ||.||    
  Fly   154 -------YRDDSDLQNF-IDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINA 210

  Fly   159 -----------CGYKDRTKVCEAEIYSQR---PGCRQEFVDFWAS-NTDLIRWSSLIIALFELGI 208
                       |||..:.:...|.  |:|   .|| .|.|..|.. |..:|...:|.|||.:|.:
  Fly   211 TDISSGLVNIMCGYGVQVRSVAAA--SKRIWTSGC-IEIVRVWVERNLYVIAGVALGIALLQLFV 272

  Fly   209 FIMS 212
            ..::
  Fly   273 IYLA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 69/260 (27%)
tetraspanin_LEL 104..191 CDD:239401 30/134 (22%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 60/240 (25%)
penumbra_like_LEL 132..255 CDD:239411 30/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.