DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp74F

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:245 Identity:56/245 - (22%)
Similarity:96/245 - (39%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILL-------IVVGSIMLSTMGNFTAFDGGVNTQTIPICIIV 58
            |:|.....||.|::.|.|...||.::       :|..|.:...:|. ..|.|.|      ..::|
  Fly     7 MDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGT-NLFSGAV------YVLLV 64

  Fly    59 IGSVTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSM--------- 114
            ...:..:|:|.||.|..:|..|....|.|.:.::|...|...:..:...::...:|         
  Fly    65 TSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMA 129

  Fly   115 ----GKAVDKAWDENNAAQGYPMDALQLAFSCCG-NT--GYQQYETVPSSCCG--YKDRTKVCE- 169
                .:.:.:||           |..|....||| :|  .:.:|..||.|||.  :..:.|.|. 
  Fly   130 LYGSRREITQAW-----------DLTQERLQCCGVDTWHDWNRYGPVPESCCQELFGGQRKECTI 183

  Fly   170 ----AEIYSQRPGCRQEFVDFWASNTDLIRWSSLIIALFELGIFIMSCCL 215
                ..:|:|  ||.....:|...:..:|..:|:.:|:..:...|.||.|
  Fly   184 FPTITNLYNQ--GCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 54/238 (23%)
tetraspanin_LEL 104..191 CDD:239401 22/109 (20%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 53/236 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.