DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp66E

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:270 Identity:63/270 - (23%)
Similarity:100/270 - (37%) Gaps:76/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYLLYLLNLVFVAGGILLIVVG------------SIMLSTMGNFTAFDGGVNTQTIPICIIVIGS 61
            ||||.:.|.:|...|.::..||            .:.|........|......:.:...::|||:
  Fly    11 KYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYVLLVIGA 75

  Fly    62 VTFVVAFFGCCGTIRENACCTTIYAICMLILF-------GLQLALSIWIFAANDKFLS------S 113
            |.|.::|.|..|.:||:.|..:.|...:::|.       ||.......:.|.:..||.      |
  Fly    76 VMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTTITSYS 140

  Fly   114 MGKAVDKA---WDENNAAQGYPMDALQLAFSCCGNTGYQQYE------------TVPSSCCGYKD 163
            :|:.||..   |::           |...|.|||...|..::            |:|.:||..||
  Fly   141 LGENVDATSLMWNQ-----------LMGNFGCCGINDYHDFDASPAWVNGKGNRTIPDACCILKD 194

  Fly   164 RTKVCEAE------------IYSQRPGCRQEFVDFWASNTDLIRWSSLIIALFELGI-----FIM 211
            ..|:...:            .|  :.||.:.|.: |     |||...|:|....:||     .|:
  Fly   195 VAKLVPRDEDCTTNPSDSNSFY--KKGCYEVFTE-W-----LIRQRELVIVAIAVGIVHLVLIIL 251

  Fly   212 SCCLASAMRK 221
            :..|..|..|
  Fly   252 AFALCKAFAK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 61/266 (23%)
tetraspanin_LEL 104..191 CDD:239401 26/119 (22%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 61/265 (23%)
uroplakin_I_like_LEL 116..231 CDD:239409 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.