DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp42Er

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:223 Identity:57/223 - (25%)
Similarity:97/223 - (43%) Gaps:35/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFVVAFFGC 71
            |.:||.:|.|.:....||..|||..|.:..:        ....|.|....|.:||:.|:::||||
  Fly     7 MIRYLAFLFNFLCAVLGIATIVVNVIAIDQI--------APKDQLILGLYIAVGSIVFLLSFFGC 63

  Fly    72 CGTIRENACCTTIYAICMLILFGLQLALSIWIFAAN--DKFLSSMGKAVDKAWDENNAAQGYPMD 134
            .|.|:|:.|.|..||..||::..:.:.: :::|..:  :..::.:.:|..|..:..:|...|   
  Fly    64 FGAIKESICVTWAYATSMLVMLIVSIVM-LFVFRMHFEEDSITKLKQAFAKQTNTFDAMAEY--- 124

  Fly   135 ALQLAFSCCGNTGYQQYE----TVPSSCCGYKDRTKVCEAEIYSQRPGCRQEF---VDFWASNTD 192
              |..:.|||....:.|.    ||||||....|.         ..|.||..:.   .:.......
  Fly   125 --QTQYQCCGIYKLKDYGDAYITVPSSCYDQNDT---------PYRDGCLAKMETQYEELLKGPK 178

  Fly   193 LIRWSSLIIALFELGIFIMSCCLASAMR 220
            ::.|..::|   |:|.|..|..:..::|
  Fly   179 IVGWMLMVI---EIGAFTFSTIMGVSLR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 55/219 (25%)
tetraspanin_LEL 104..191 CDD:239401 20/95 (21%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 54/212 (25%)
tetraspanin_LEL 93..174 CDD:239401 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467709
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26943
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.