DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:236 Identity:53/236 - (22%)
Similarity:86/236 - (36%) Gaps:42/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CL---SAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTF 64
            ||   |.:|..|..::       |:|..:.|...|.      .|:.|....|.....:.:.....
  Fly     7 CLQWTSVVFSTLTLIV-------GVLAALAGVYELD------KFNEGSAEHTEKFVQLGMAGALI 58

  Fly    65 VVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIW-IFAAND-KFLSSMGKAVDKAWDENNA 127
            :....||.|.|..:.....:..|.:|.|    :|..|| :...|: |.|.:....|...|.:...
  Fly    59 LAGLVGCLGAIFGSIKVMVVNLILLLAL----IASHIWKVSHYNETKQLDATEVYVMDLWMKELV 119

  Fly   128 AQGYPMDALQLAFSCCGNTGYQQYET----VPSSCCGYKDRTKVCEAEIYSQRPGC----RQEFV 184
            ..| .|..||..:.|||:.|:..|.:    ||.||...||....    :|....||    ::.::
  Fly   120 HHG-AMQDLQQEYECCGDKGFSDYTSLNMKVPRSCFHTKDGIHA----LYPYGEGCMAAVKRAYL 179

  Fly   185 DFWASNTDLIRWSSLIIALFE-LGIF--IMSCCLASAMRKR 222
            ..:...    :|....:..:| :||.  |..||..:...:|
  Fly   180 QIYRYE----KWVHCGLIGYEVVGIILGITLCCQLTNKTRR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 49/223 (22%)
tetraspanin_LEL 104..191 CDD:239401 23/95 (24%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 52/228 (23%)
tetraspanin_LEL 110..178 CDD:239401 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.