DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and lbm

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:231 Identity:63/231 - (27%)
Similarity:100/231 - (43%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLV--FVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVT 63
            |.|.:...|....:||.|  |:|.|.:             .:.|::....|:...|...:..|:.
  Fly     1 MGCATTSVKIASIVLNAVLGFLAAGAI-------------GWIAYNADTETEEFVIAAYIACSLI 52

  Fly    64 FVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGK-AVDKAWDENNA 127
            .|.|..|....|||:...|...|:.:|||..||: :|..:|.  .:|....|: .|:.||..|| 
  Fly    53 LVFALLGIFAAIRESVVLTATSAVFLLILAILQI-VSTCLFL--HEFDVKSGRDMVEVAWQANN- 113

  Fly   128 AQGYPMDALQLAFSCCGNTGYQQY----ETVPSSCCGYKDRTKVCEAEIYSQRPGCRQEFVDFWA 188
                 ||:||....|||.:..|.|    ..:|.||  |.|..:..: .:|..  ||.::...|:.
  Fly   114 -----MDSLQQKHECCGQSSAQDYIHLSLLIPPSC--YADLQQTPD-HLYLD--GCIEKVQSFYE 168

  Fly   189 SNTDLIRW--SSLIIALFELGIFIMSCCLASAMRKR 222
            |  |.:|:  .|.::..|||..|.::..||.:.:.:
  Fly   169 S--DKLRFIIVSWVLVAFELICFALAVFLAISFKNK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 61/219 (28%)
tetraspanin_LEL 104..191 CDD:239401 27/91 (30%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 61/218 (28%)
tetraspanin_LEL <109..169 CDD:239401 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467727
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.