DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp42El

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:227 Identity:67/227 - (29%)
Similarity:100/227 - (44%) Gaps:33/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFV 65
            |.|.:...||.|:|.|.::...|||:::.|.:....|.:..|           |.|:::|....|
  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGGLGWGAMPDAYA-----------IGILILGGTILV 54

  Fly    66 VAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDENNAAQG 130
            ::.|||||.:||:......||..:|||  |.|.::..|....|.|.....:.|:..|:......|
  Fly    55 ISLFGCCGAVRESPRMLWTYASLLLIL--LLLIVAFIILNPKDVFKKYALQTVENQWELEQTKPG 117

  Fly   131 YPMDALQLAFSCCGNTGYQQY-------ETVPSSCCGYKDRTKVCEAEIYSQRPGC----RQEFV 184
             .||.:|..:.|||....|.|       .|||||||  ||.:.|....:|.:  ||    .:.|.
  Fly   118 -SMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCC--KDDSCVNPLNLYVR--GCLIKVEEAFA 177

  Fly   185 DFWASNTDLIRWSSLIIALFELGIFIMSCCLA 216
            | .|:....:.|..|   .|...|.:::..||
  Fly   178 D-EATTLGYLEWGLL---GFNAVILLLAIILA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 65/220 (30%)
tetraspanin_LEL 104..191 CDD:239401 29/97 (30%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 62/210 (30%)
tetraspanin_LEL 94..178 CDD:239401 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467698
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26943
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.