DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:211 Identity:57/211 - (27%)
Similarity:88/211 - (41%) Gaps:27/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFVVAFFGCC 72
            :||.|.:..::.|...:.....|   ::|.|:..:..|...:   .:|    |...|.|||.|..
  Fly    10 WKYGLLVTCILIVTCNVFFFSCG---VTTWGSAVSVYGSYGS---ALC----GGAVFGVAFLGMY 64

  Fly    73 GTIRENACCTTIYAICMLILFGLQL-ALSIWIFAANDKFLSSMGKAVDKAWD--ENNAAQGYPMD 134
            ..::    .:..|:|..||..||.: ||..::|.........||:..::..|  |........|.
  Fly    65 VALK----VSYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSDDKMQ 125

  Fly   135 ALQLAFSCCGNTGYQQY-----ETVPSSCCGYKDRTKVCEAEIYSQRPGCRQEFVDFWASNTDLI 194
            .:...|.|||..|.|.|     ..:|||||...|.:|  .|.:|.:  ||..:.|.......:|.
  Fly   126 PVHSLFGCCGIEGPQDYLQEEHGALPSSCCYAFDCSK--PAHVYEE--GCSTKAVATLRMQAELN 186

  Fly   195 RWSSL-IIALFELGIF 209
            .:|.: ||||..||:|
  Fly   187 YYSCMAIIALEFLGLF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 57/211 (27%)
tetraspanin_LEL 104..191 CDD:239401 25/93 (27%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 57/210 (27%)
tetraspanin_LEL 97..183 CDD:239401 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.