DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:194 Identity:58/194 - (29%)
Similarity:82/194 - (42%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYLLYLLNLVFVAGGILLIVVGSIML-------STMGNFTAFDGGVNTQTIPICIIVIGSVTFVV 66
            |::|.|||.||...|:.||..|...|       .::|...|  ||:        ||.:|.|..::
  Fly     9 KHVLLLLNFVFSVLGLALIAFGIFFLISAAENAVSIGKNVA--GGL--------IIALGVVILII 63

  Fly    67 AFFGCCGTIRENACCTTIY--AICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWD-ENN-- 126
            |.|||...|.|......||  |:.:|||..| :.|.:......|....|:.:..|:.|: |.|  
  Fly    64 AIFGCLAAIHEAPVRLLIYVGAVVLLILAQL-IFLGMSSHGTKDGISGSINEGFDRLWESERNQT 127

  Fly   127 AAQGYPMDALQLAFSCCGNTGYQQY----ETVPSSCCGYKDRTKVCEAEIYSQRPGCRQEFVDF 186
            .|..|....||    |||....:.|    ..:|||||   ..:|..:......:.||:..||.:
  Fly   128 GALSYYESWLQ----CCGVNSSEDYWIIHHGIPSSCC---PESKCMDTPSRVFKTGCKAAFVKY 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 58/194 (30%)
tetraspanin_LEL 104..191 CDD:239401 24/90 (27%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 58/194 (30%)
DUF373 <17..>101 CDD:299895 29/94 (31%)
tetraspanin_LEL 104..189 CDD:239401 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467689
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.