DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp42Eg

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster


Alignment Length:227 Identity:58/227 - (25%)
Similarity:107/227 - (47%) Gaps:39/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFV 65
            |.|.:.:.|......:::....|:::|.:|..::....:|         .|....||.:|.|..:
  Fly     1 MACSTNVLKGFALFWDIILALFGLVVIGLGVHIIYKFEHF---------NTAAFVIIAVGVVVVL 56

  Fly    66 VAFFGCCGTIRENACCTTIYAICMLILFGLQ-LALS-IWIFAANDKFLSSMGKAVDKAWDE---- 124
            .|.||..|..||::..:.::.:.:::|..|: ||:. :|:|..:  .|.::.|..||.|::    
  Fly    57 TALFGALGAARESSATSKVFVVILIVLVILEVLAVGFLWVFQTS--LLINVDKTFDKLWNDQPVP 119

  Fly   125 ---NNAAQGYPMDALQLAFSCCGNTGYQQYETVPSSCC-GYKDRTKVCEAEIYSQRPGCRQEFVD 185
               .|.:|   :.:|:....||||.|...|...|:||. |..|:..:         .||||:|:|
  Fly   120 IKPGNQSQ---IASLERWLDCCGNVGPSDYILPPNSCYNGESDKLNL---------EGCRQKFLD 172

  Fly   186 FWASNTDLIRWSSL-IIALFELGIFIMSCCLA 216
            |.|.     ||::. :::|..||:.::...||
  Fly   173 FIAD-----RWTTFNLVSLVLLGVELICALLA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 56/220 (25%)
tetraspanin_LEL 104..191 CDD:239401 28/94 (30%)
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 55/211 (26%)
tetraspanin_LEL 95..176 CDD:239401 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.