DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:247 Identity:59/247 - (23%)
Similarity:112/247 - (45%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAF-DGGVNTQTIPICIIVIGSVTF 64
            |.|.    ||:|.:::.:|....||||:||:.:.:..|:|:.| ||..::.  |..:|.||.:..
  Fly    12 MKCA----KYMLIIVSFMFALTAILLIMVGTTIQTIFGDFSLFIDGHFSSP--PALLIAIGFILI 70

  Fly    65 VVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDK----FLSSMGKAVDKAWDEN 125
            .||..|..|.::|:.....:|.:|:.::|.|:::.:|..|....:    .:.:|.:|:.:...:.
  Fly    71 AVAALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQALAEYEHDP 135

  Fly   126 NAAQGYPMDALQLAFSCCGNTGYQQYE----------------TVPSSCCG-----YKDRTKVCE 169
            ....|  :|.:|....|||....:.::                .||:||||     ..|.|::..
  Fly   136 YVESG--VDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPTSLNDSTQMTC 198

  Fly   170 AEIYSQRPGCRQEFVDFWASNTDLIRWSSLIIALFELGIFIMSCCLASAMRK 221
            .|.|..  ||.::.....:.:..||...:..:|..:|...:.:..||..:|:
  Fly   199 METYDY--GCFRKMNFIVSQSAMLIATGATTVAFVQLLGVLCAFMLAKTLRR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 56/236 (24%)
tetraspanin_LEL 104..191 CDD:239401 21/111 (19%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 57/241 (24%)
tetraspanin_LEL 110..218 CDD:239401 21/111 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1145558at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.