DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp3A

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster


Alignment Length:260 Identity:75/260 - (28%)
Similarity:118/260 - (45%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSAMFKYLLYLLNLVF-VAGGILLIV------------VGSIMLSTMGNFTAFDGGVNTQTIPIC 55
            :|...||:::|||.|| :.||:||.:            .||:.|.   ||  :|..:|   |.:.
  Fly    39 VSQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLE---NF--YDVFLN---ISLV 95

  Fly    56 IIVIGSVTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGK---- 116
            :|:.|:|.|:|:|.||.|.:|||......|::|:|:.|.|::|::|..|.......:.:.|    
  Fly    96 MILAGTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTH 160

  Fly   117 AVDKAWDENNAAQGYPMDALQLAFSCCG--NTGYQQYET---------------VPSSC------ 158
            .:..::.::...|.: :|..|..|.|||  |:|||.:..               ||.||      
  Fly   161 KIIHSYRDDPDLQNF-IDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATD 224

  Fly   159 ---------CGY-KDRTKVCEAEIYSQRPGCRQEFVDFWAS-NTDLIRWSSLIIALFELGIFIMS 212
                     ||| .....|.||.......|| .|.|..||. |..:|..::|.|||.:|.:..::
  Fly   225 ISSGLVNIMCGYGVQNAPVPEATKLIWTSGC-IEIVRVWAEHNLYVIAGNALGIALIQLLVIYLA 288

  Fly   213  212
              Fly   289  288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 74/256 (29%)
tetraspanin_LEL 104..191 CDD:239401 29/124 (23%)
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 74/257 (29%)
penumbra_like_LEL 144..267 CDD:239411 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.