DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and tsp-7

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_492636.1 Gene:tsp-7 / 192062 WormBaseID:WBGene00006633 Length:232 Species:Caenorhabditis elegans


Alignment Length:232 Identity:72/232 - (31%)
Similarity:111/232 - (47%) Gaps:35/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFVVAFFGCCG 73
            ||||:|.|||...||:.||:||||:.....|.....|.....| ||.::||||:..::.|.||||
 Worm    10 KYLLFLANLVLWVGGLSLIIVGSILQLKFDNVLDILGDERLAT-PILLLVIGSLCTLLGFLGCCG 73

  Fly    74 TIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMG-------------KAVDKAWDEN 125
            .||||.|.|..:|:.:.:|...::|..|..:|.:|.|...:|             :.|:.|||:.
 Worm    74 AIRENYCLTVSFAVLLALLITCEIAAVIIGYALHDSFRLGIGNQLQTGMVRYHESRGVESAWDKT 138

  Fly   126 NAAQGYPMDALQLAFSCCGNTG---YQQYETVPSSCCGYKDRTKVC---EAEIYSQRPGCRQEFV 184
            :          || |.|||.|.   :..:.|:|.|||  .:..:.|   .|.::  .|||.....
 Worm   139 H----------QL-FECCGVTNSSDWLTFTTIPDSCC--IEEIEGCARENAPLF--EPGCIHSVE 188

  Fly   185 DFWASNTDLIRWSSLIIALFELGIFIMSCCLASAMRK 221
            .:...|..::.....::|..:|.....:|||:.::.|
 Worm   189 QWVLKNGAMVGGICAVLAAIQLVGVCFACCLSKSILK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 71/228 (31%)
tetraspanin_LEL 104..191 CDD:239401 25/105 (24%)
tsp-7NP_492636.1 Tetraspannin 8..223 CDD:278750 71/228 (31%)
NET-5_like_LEL 104..195 CDD:239418 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.