DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and tsp-6

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001294830.1 Gene:tsp-6 / 13219712 WormBaseID:WBGene00006632 Length:237 Species:Caenorhabditis elegans


Alignment Length:245 Identity:70/245 - (28%)
Similarity:116/245 - (47%) Gaps:41/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CLSAMFKYLLYLLN-LVFVAGGILL-----IVVGSIMLSTMGNFTAFD-----GGVNTQTIPICI 56
            |.:...||..:|:| |.||.|.|::     ::|....|:|:.:....|     ..||.|.:...:
 Worm     5 CGNKCVKYFFWLINFLFFVLGAIIVGLSIWMLVDKNSLNTVASTVKVDLSQILSQVNIQQLNSFL 69

  Fly    57 ---IVIGSVTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAV 118
               ||||....|:.||||||:..|:.|..:||.|.:||||.::: ::|.::..|.   :::.:..
 Worm    70 YVAIVIGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEV-VAIVLYFVNK---TNLQQGF 130

  Fly   119 DKAW-DE-----NNAAQGYP-MDALQLAFSCCGNTG---YQQYETVPSSC-CGYKDRTKVCEAEI 172
            ...| ||     |...|.:. :|.:|.:..|||.:|   |..|...|:|| |          |.|
 Worm   131 QTIWRDELVSKYNTQQQIHQVLDQIQSSLQCCGASGCSDYIPYGAFPTSCQC----------ATI 185

  Fly   173 YSQRPGCRQEFVDFWASNTDLIRWSSLIIALFELGIFIMSCCLASAMRKR 222
              |:.||.....:.:.|:...:.:..:||...||...|.||.:..|::::
 Worm   186 --QQAGCATVIWNSFESSLIYVAFVGIIILFVELLAMIFSCIIIGAVKEK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 68/235 (29%)
tetraspanin_LEL 104..191 CDD:239401 24/97 (25%)
tsp-6NP_001294830.1 Tetraspannin 9..227 CDD:278750 68/233 (29%)
tetraspanin_LEL 120..202 CDD:239401 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.