DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and TML25

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_013219.1 Gene:TML25 / 850809 SGDID:S000004108 Length:227 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:84/220 - (38%)
Similarity:117/220 - (53%) Gaps:34/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TLIFMHGLGDTGHGWSSALAAI--RPP----FMKVICPTAPTQPVSLNAGFRMPSWFDLKTLDIG 74
            |:||:|||||||.||......:  |.|    ....:.|.||...|:.|.|..||:|||:...|  
Yeast    16 TIIFLHGLGDTGSGWGFLAQYLQQRDPAAFQHTNFVFPNAPELHVTANGGALMPAWFDILEWD-- 78

  Fly    75 GPE----DEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQPLAGVVAL 135
             |.    |..|..::.:|:...:::||..||...:|::||||||.||||.:::|....:.|:|||
Yeast    79 -PSFSKVDSDGFMNSLNSIEKTVKQEIDKGIKPEQIIIGGFSQGAALALATSVTLPWKIGGIVAL 142

  Fly   136 S--CWLP----LHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSF------MKNVT 188
            |  |.:|    .||.  |..|.:   |||..|||.|||||...| :.|   |.|      ::|..
Yeast   143 SGFCSIPGILKQHKN--GINVKT---PIFHGHGDMDPVVPIGLG-IKA---KQFYQDSCEIQNYE 198

  Fly   189 FKTYSGLSHSSSDDEMDDVKDIISK 213
            ||.|.|::||:..||::|:...|.|
Yeast   199 FKVYKGMAHSTVPDELEDLASFIKK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 84/220 (38%)
TML25NP_013219.1 Abhydrolase_2 1..225 CDD:396693 84/220 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I1140
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I1248
Isobase 1 0.950 - 0.993157 Normalized mean entropy S960
OMA 1 1.010 - - QHG53978
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - oto100234
orthoMCL 1 0.900 - - OOG6_100696
Panther 1 1.100 - - LDO PTHR10655
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R75
SonicParanoid 1 1.000 - - X443
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.