DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and AT1G52700

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001321415.1 Gene:AT1G52700 / 841703 AraportID:AT1G52700 Length:255 Species:Arabidopsis thaliana


Alignment Length:223 Identity:79/223 - (35%)
Similarity:116/223 - (52%) Gaps:27/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWFDLKT 70
            :|....|..|||:::|||||.|...|..:.::..|.:|.||||||::||:...||...:|||:..
plant    25 VVRPKGKHQATLVWLHGLGDNGSSSSQLMDSLHLPNIKWICPTAPSRPVTSLGGFTCTAWFDVGE 89

  Fly    71 LDIGGPEDEPGIQSARDSVHGMIQKEISAGIPAN-RIVLGGFSQGGALALYSAL----------- 123
            :...|.:|..|:.::...:..::..|     ||: ::.:||||.|.|::||||.           
plant    90 ISEDGHDDLEGLDASASHIANLLSSE-----PADVKVGIGGFSMGAAISLYSATCYALGRYGTGH 149

  Fly   124 TYDQPLAGVVALSCWLP--------LHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSA-SL 179
            .|...|..||.||.|||        :...|..|: .:..:||...||..|.||||:||:.|| ||
plant   150 AYPINLQAVVGLSGWLPGWKSLRSKIECSFEAAR-RAASLPIILTHGTSDDVVPYRFGEKSAQSL 213

  Fly   180 LKSFMKNVTFKTYSGLSHSSSDDEMDDV 207
            ..:..:...||.|.||.|.:...|||:|
plant   214 GMAGFRLAMFKPYEGLGHYTVPREMDEV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 79/223 (35%)
AT1G52700NP_001321415.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 144 1.000 Domainoid score I1482
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I1760
OMA 1 1.010 - - QHG53978
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - otm2673
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X443
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.