DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and AT1G52695

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_849799.1 Gene:AT1G52695 / 841702 AraportID:AT1G52695 Length:231 Species:Arabidopsis thaliana


Alignment Length:214 Identity:56/214 - (26%)
Similarity:84/214 - (39%) Gaps:29/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWFDLKTLDIGGPEDE 79
            ||::::|.:|:||......|..:|.|.:|.||||||.:.|:...|....:|.|:..:.....:|.
plant    27 ATIVWLHDVGNTGFNSLEPLQNLRLPNIKWICPTAPRRRVTSLGGEITNAWCDIAKVSENMQDDF 91

  Fly    80 PGIQSARDSVHGMIQKEISAGIPANRIV-LGGFSQGGALALYSALTYD---QPLAG--VVALSCW 138
            ..:....:.:..:...|     |.|.|. :.|...|.|.|||....|.   .|:..  |:.::.|
plant    92 GTLNYVNEYITSLFSNE-----PQNVIKGVAGLGLGAAQALYYTSCYAFGWVPINPQIVIGINGW 151

  Fly   139 LPLHKQFP--------GAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMKNVTFKTYSGL 195
            ||..::..        |....:....|...||..|.|||..||...|..|:.......||...| 
plant   152 LPGWRRLEYNMNNTNFGTANRAAASKILILHGTSDDVVPSSFGYRCADSLRMAGFPTLFKQCGG- 215

  Fly   196 SHSSSDDEMDDVKDIISKW 214
                     |.|.:.|..|
plant   216 ---------DHVINEIRVW 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 55/212 (26%)
AT1G52695NP_849799.1 Abhydrolase 25..202 CDD:419691 48/179 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I1760
OMA 1 1.010 - - QHG53978
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - otm2673
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X443
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.