DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and AT1G52460

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_175655.2 Gene:AT1G52460 / 841677 AraportID:AT1G52460 Length:230 Species:Arabidopsis thaliana


Alignment Length:246 Identity:52/246 - (21%)
Similarity:90/246 - (36%) Gaps:72/246 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APVIVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKV--------ICPTAPTQPVSLNAG 59
            |..:|:...:...|::::|   |....:|.::     .|:|:        |||:. ..|.|.|  
plant    10 ADFVVQPKGEHRVTIVWLH---DKDEHFSDSV-----QFVKILNLNNIKWICPSL-VLPTSRN-- 63

  Fly    60 FRMPSWFDLKTLDIGGPEDEPGIQSA----RDSVHGMIQKEISAGIPANRIV-LGGFSQGGALAL 119
                             :.|..|..|    .:.|..:...|     |.|.|. :|||..|.|:||
plant    64 -----------------KPEYNINHALYLTAERVANLFSDE-----PENVIKGVGGFGMGAAVAL 106

  Fly   120 YSALT-----YDQPLAGVVALSCWLPLHKQFP-GAKVNSDDVP-------IFQAHGDYDPVVPY- 170
            :.|.:     |......||.:|.||...|... ..:..|.:.|       |...||..|. ||: 
plant   107 HFATSCALNHYTINPRVVVGISGWLSKAKSLKRSIEFASYEAPPRAASQSILLTHGQRDH-VPHL 170

  Fly   171 -KFGQLSASLLKSF----MKNVTFKTYSGLSHSSSDDEMDDVKDIISKWTQ 216
             ..|:.:|.:|:..    ::.:.|..:..::|..:.:.|      :..|.:
plant   171 CGCGEEAAFILREAGFRDVRFLPFARFGPIAHEINRNVM------VKSWLE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 50/241 (21%)
AT1G52460NP_175655.2 Abhydrolase 12..>167 CDD:304388 42/188 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X443
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.