DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and AT1G52440

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_175653.2 Gene:AT1G52440 / 841675 AraportID:AT1G52440 Length:200 Species:Arabidopsis thaliana


Alignment Length:129 Identity:33/129 - (25%)
Similarity:54/129 - (41%) Gaps:20/129 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LGGFSQGGALALYSALT-----YDQPLAGVVALSCWL--------PLHKQFPGAKVNSDDVPIFQ 159
            :||...|.|:||:.|.:     |......||.:|.||        .:.....||...:....||.
plant    70 VGGLGMGAAVALHFATSCALNHYTINPRVVVGISGWLSNSGSLKRSIESASHGAPARAASQSIFI 134

  Fly   160 AHGDYDPVV-PYKFGQLSA-SLLKSFMKNVTFKTYSGL---SHSSSDDEMDDVKDIISKWTQWD 218
            .||..|.|. |...|:.:. ||.::..::|.|..::..   :|.::.:.|  ||..:.:..|.|
plant   135 THGICDSVPHPCDCGEEAVLSLREAGFRDVKFTPFARFGPTAHENNRNVM--VKSWLEEKLQLD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 31/123 (25%)
AT1G52440NP_175653.2 Abhydrolase 16..>142 CDD:304388 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X443
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.