DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and SOBER1

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_193961.3 Gene:SOBER1 / 828325 AraportID:AT4G22300 Length:262 Species:Arabidopsis thaliana


Alignment Length:219 Identity:77/219 - (35%)
Similarity:110/219 - (50%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LIFMHGLGDTGHGWSSALAAIRPPF-------MKVICPTAPTQPVSLNAGFRMPSWFDLKTLDI- 73
            ::::|||||:|    .|...|:..|       .|.:.|:||..|||.|.|..||||||:..|.: 
plant    51 ILWLHGLGDSG----PANEPIKTLFRSQEFRNTKWLFPSAPPNPVSCNYGAVMPSWFDIPELPLT 111

  Fly    74 -GGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQPLAGVVALSC 137
             |.|:||..:..|..:||.:|.|||:.||....:.:.||||||||.|.|.|.|.:.:.|....|.
plant   112 AGSPKDESSLLKAVKNVHAIIDKEIAGGINPENVYICGFSQGGALTLASVLLYPKTIGGGAVFSG 176

  Fly   138 WLPLH----KQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMKNVTFKTYSGLSHS 198
            |:|.:    .||   ..::...||..:||..|..|.::.||.:...|:.......||.|.||.||
plant   177 WIPFNSSITNQF---TEDAKKTPILWSHGIDDKTVLFEAGQAALPFLQQAGVTCEFKAYPGLGHS 238

  Fly   199 SSDDEMDDVKDIISKWTQWDSQNM 222
            .|::|:..::       .|..|.|
plant   239 ISNEELQYLE-------SWLKQRM 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 74/209 (35%)
SOBER1NP_193961.3 Abhydrolase 51..252 CDD:304388 75/214 (35%)
MhpC 51..>180 CDD:223669 53/132 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53978
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100696
Panther 1 1.100 - - LDO PTHR10655
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X443
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.