powered by:
Protein Alignment CG18815 and AT1G18773
DIOPT Version :9
Sequence 1: | NP_001261719.1 |
Gene: | CG18815 / 59176 |
FlyBaseID: | FBgn0042138 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001321609.1 |
Gene: | AT1G18773 / 6240661 |
AraportID: | AT1G18773 |
Length: | 73 |
Species: | Arabidopsis thaliana |
Alignment Length: | 54 |
Identity: | 11/54 - (20%) |
Similarity: | 23/54 - (42%) |
Gaps: | 10/54 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 AKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMKNVTFKTYSGLSHSSSD 201
|:...:..|:..:||..:..|.::.||.:...|:. :||::...|
plant 18 AQAAMEHTPVLWSHGIDEKAVLFEAGQAALPFLQQ----------AGLTYEFKD 61
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG18815 | NP_001261719.1 |
Abhydrolase_2 |
4..214 |
CDD:280406 |
11/54 (20%) |
AT1G18773 | NP_001321609.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0400 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1373549at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000652 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.