DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and AT1G18773

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001321609.1 Gene:AT1G18773 / 6240661 AraportID:AT1G18773 Length:73 Species:Arabidopsis thaliana


Alignment Length:54 Identity:11/54 - (20%)
Similarity:23/54 - (42%) Gaps:10/54 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 AKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMKNVTFKTYSGLSHSSSD 201
            |:...:..|:..:||..:..|.::.||.:...|:.          :||::...|
plant    18 AQAAMEHTPVLWSHGIDEKAVLFEAGQAALPFLQQ----------AGLTYEFKD 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 11/54 (20%)
AT1G18773NP_001321609.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.