DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Apt1 and AT1G18773

DIOPT Version :10

Sequence 1:NP_001261719.1 Gene:Apt1 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001321609.1 Gene:AT1G18773 / 6240661 AraportID:AT1G18773 Length:73 Species:Arabidopsis thaliana


Alignment Length:54 Identity:11/54 - (20%)
Similarity:23/54 - (42%) Gaps:10/54 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 AKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMKNVTFKTYSGLSHSSSD 201
            |:...:..|:..:||..:..|.::.||.:...|:.          :||::...|
plant    18 AQAAMEHTPVLWSHGIDEKAVLFEAGQAALPFLQQ----------AGLTYEFKD 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Apt1NP_001261719.1 Abhydrolase_2 1..214 CDD:396693 11/54 (20%)
AT1G18773NP_001321609.1 YpfH <17..60 CDD:440169 10/51 (20%)

Return to query results.
Submit another query.