DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and lypla1

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001017616.1 Gene:lypla1 / 550279 ZFINID:ZDB-GENE-050417-87 Length:196 Species:Danio rerio


Alignment Length:217 Identity:98/217 - (45%)
Similarity:131/217 - (60%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAPV--IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMP 63
            |:||:  ||.|..|.||.:||:||||||||||:.|:|.||.|.:|.|||.||..||:||....||
Zfish     6 MSAPLPTIVPAACKATAAVIFLHGLGDTGHGWAQAMAGIRTPHVKYICPHAPVMPVTLNMNMAMP 70

  Fly    64 SWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQP 128
            ||||:.:|:....|||.||:.|.::|..:|.:|:..|||::|||||||||               
Zfish    71 SWFDIISLNPNAQEDESGIKRAAENVKALIDQEVKNGIPSHRIVLGGFSQ--------------- 120

  Fly   129 LAGVVALSCWLPLHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMK--NVTFKT 191
              .|::                .:.|:.:.|.||:.||:||..||||:...|||.:|  ||||||
Zfish   121 --SVIS----------------KNKDISVLQCHGEADPLVPLIFGQLTVEKLKSMLKPSNVTFKT 167

  Fly   192 YSGLSHSSSDDEMDDVKDIISK 213
            |||::||:..:||.|:|..|.|
Zfish   168 YSGMTHSACPEEMMDIKQFIEK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 96/214 (45%)
lypla1NP_001017616.1 Abhydrolase_2 11..189 CDD:280406 94/210 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592190
Domainoid 1 1.000 245 1.000 Domainoid score I2145
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 247 1.000 Inparanoid score I3249
OMA 1 1.010 - - QHG53978
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - otm24372
orthoMCL 1 0.900 - - OOG6_100696
Panther 1 1.100 - - LDO PTHR10655
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X443
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.