DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and lyplal1

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001011253.1 Gene:lyplal1 / 496699 XenbaseID:XB-GENE-953501 Length:235 Species:Xenopus tropicalis


Alignment Length:215 Identity:76/215 - (35%)
Similarity:119/215 - (55%) Gaps:11/215 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRP-----PFMKVICPTAPTQPVSLNAGFRMPSW 65
            :|....|.:|::||:||.||:|.|..|.:..|..     ..:|||.|||||:|.:...|.....|
 Frog    11 VVAPAGKHSASVIFLHGSGDSGQGIKSWIREILKQDLAFKHIKVIFPTAPTRPYTPMNGALSSVW 75

  Fly    66 FDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQPLA 130
            ||...:.|..||....:.|....:..:|.:|::.||..|||:|||||.|||:|::.|..|.:.:|
 Frog    76 FDRYKISIQSPEHLESMDSMCQVLTSLINEEVNMGIMKNRILLGGFSMGGAMAMHLAYRYHKDVA 140

  Fly   131 GVVALSCWLP----LHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMKNVTFKT 191
            ||.|||.:|.    |:|....||.:..:  :||.||..|.:|.:|:|:.:.:||||...:.:|.:
 Frog   141 GVFALSSFLNNGSILYKALKEAKSSLPE--LFQCHGVADELVLHKWGEETNNLLKSLGVSSSFHS 203

  Fly   192 YSGLSHSSSDDEMDDVKDII 211
            :..|.|..:..|::.::..|
 Frog   204 FPNLYHELNLPELEQLRSWI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 76/215 (35%)
lyplal1NP_001011253.1 Abhydrolase 11..223 CDD:328752 75/213 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.