DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and lypla1

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001005699.1 Gene:lypla1 / 448212 XenbaseID:XB-GENE-942736 Length:230 Species:Xenopus tropicalis


Alignment Length:219 Identity:124/219 - (56%)
Similarity:153/219 - (69%) Gaps:6/219 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAPV--IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMP 63
            |:||:  ||.|..|.||.:||:||||||||||:.|:|:|:.|.:|.|||.||..|||||....||
 Frog     6 MSAPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAMASIKSPHVKYICPHAPIMPVSLNMNMAMP 70

  Fly    64 SWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQP 128
            ||||:..|.....|||.||:.|.::|..:|.:||..|||:|||:||||||||||:||:|||..|.
 Frog    71 SWFDIIGLSPDAQEDEAGIKRAAENVKALIDQEIKNGIPSNRIILGGFSQGGALSLYTALTTQQK 135

  Fly   129 LAGVVALSCWLPLHKQFPGAKVNS--DDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMK--NVTF 189
            |||||||||||||...||.|..||  .||.:.|.||:.||:||..||.|::..||:.:.  |:.|
 Frog   136 LAGVVALSCWLPLRSSFPQAAANSANKDVAVLQCHGESDPLVPLMFGTLTSEKLKTIISPANINF 200

  Fly   190 KTYSGLSHSSSDDEMDDVKDIISK 213
            ||||||.|||.:.||.|:|..|.|
 Frog   201 KTYSGLMHSSCNQEMTDIKQFIDK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 122/216 (56%)
lypla1NP_001005699.1 Abhydrolase_2 11..224 CDD:280406 120/212 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2141
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I3216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - otm49349
Panther 1 1.100 - - LDO PTHR10655
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X443
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.