DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and Lyplal1

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001099456.2 Gene:Lyplal1 / 289357 RGDID:1311195 Length:235 Species:Rattus norvegicus


Alignment Length:217 Identity:69/217 - (31%)
Similarity:105/217 - (48%) Gaps:27/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVEATVKQTATLIFMHGLGDTGHG---WSSALAAIRPPF--MKVICPTAPTQPVS-LNAGFRMPS 64
            :|....:.:|:|||:||.||:|.|   |...:......|  :|:|.||||::|.: |..|| ...
  Rat    14 VVSPAGRHSASLIFLHGSGDSGQGLRQWIKQVLNQDLTFQHIKIIYPTAPSRPYTPLKGGF-SNV 77

  Fly    65 WFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQPL 129
            |||...:....||....|.|....:.|:|..|:..||..:||::||||.||.:|::.|......:
  Rat    78 WFDRFKISNDCPEHLESIDSMCQVLTGLIDDEVKNGIEKSRILIGGFSMGGCMAMHLAYRKHPGV 142

  Fly   130 AGVVALSCWLPL-----------HKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSF 183
            |||..||.:|..           .:.||         .:||.||..|.:|.:.:|:.:.|.|||.
  Rat   143 AGVFVLSGFLNKASAVYQDLQQGGRAFP---------ELFQCHGTADDLVLHAWGEETNSNLKSL 198

  Fly   184 MKNVTFKTYSGLSHSSSDDEMD 205
            ..:.||.:...:.|..|..|::
  Rat   199 GVSTTFHSLPDVYHELSRPELE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 69/217 (32%)
Lyplal1NP_001099456.2 Abhydrolase 15..222 CDD:419691 69/216 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.