DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and Lypla2

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_036072.1 Gene:Lypla2 / 26394 MGIID:1347000 Length:231 Species:Mus musculus


Alignment Length:221 Identity:116/221 - (52%)
Similarity:152/221 - (68%) Gaps:8/221 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAPVIVEATV-----KQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF 60
            |:.|::.:|..     ::||.:||:||||||||.|:.||:.||.|.:|.|||.||..||:||...
Mouse     6 MSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM 70

  Fly    61 RMPSWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTY 125
            .|||||||..|....||||.||:.|.:::..:|:.|:..||||||||||||||||||:||:|||.
Mouse    71 VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTC 135

  Fly   126 DQPLAGVVALSCWLPLHKQFP-GAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFM--KNV 187
            ..||||:||||||||||:.|| .|..::.|:.|.|.||:.||:||.:||.|:|..|::.:  ..|
Mouse   136 PHPLAGIVALSCWLPLHRNFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRTVVTPARV 200

  Fly   188 TFKTYSGLSHSSSDDEMDDVKDIISK 213
            .||||.|:.|||...||..||:.:.|
Mouse   201 QFKTYPGVMHSSCPQEMAAVKEFLEK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 115/218 (53%)
Lypla2NP_036072.1 Abhydrolase_2 14..228 CDD:280406 114/213 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2351
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100964
Inparanoid 1 1.050 235 1.000 Inparanoid score I3392
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53978
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - otm44176
orthoMCL 1 0.900 - - OOG6_100696
Panther 1 1.100 - - LDO PTHR10655
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R75
SonicParanoid 1 1.000 - - X443
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.