DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and Lypla1

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038965233.1 Gene:Lypla1 / 25514 RGDID:3025 Length:235 Species:Rattus norvegicus


Alignment Length:205 Identity:110/205 - (53%)
Similarity:137/205 - (66%) Gaps:6/205 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAPV--IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMP 63
            |:||:  :|.|..|.||.:||:||||||||||:.|.|.|:...:|.|||.||..||:||....||
  Rat     6 MSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMPVTLNMSMMMP 70

  Fly    64 SWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQP 128
            ||||:..|.....|||.||:.|.::|..:|.:|:..|||:|||:||||||||||:||:|||..|.
  Rat    71 SWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQK 135

  Fly   129 LAGVVALSCWLPLHKQFPGAKVNS--DDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMK--NVTF 189
            ||||.||||||||...|....:||  .|:.:.|.|||.||:||..||.|:...||..:.  ||||
  Rat   136 LAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKGLVNPANVTF 200

  Fly   190 KTYSGLSHSS 199
            |.|.|:.|||
  Rat   201 KVYEGMMHSS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 108/202 (53%)
Lypla1XP_038965233.1 Abhydrolase_2 8..229 CDD:396693 109/203 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350480
Domainoid 1 1.000 230 1.000 Domainoid score I2366
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3345
OMA 1 1.010 - - QHG53978
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - otm46267
orthoMCL 1 0.900 - - OOG6_100696
Panther 1 1.100 - - LDO PTHR10655
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X443
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.