DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and SPAC9G1.08c

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_593563.1 Gene:SPAC9G1.08c / 2542787 PomBaseID:SPAC9G1.08c Length:241 Species:Schizosaccharomyces pombe


Alignment Length:239 Identity:63/239 - (26%)
Similarity:91/239 - (38%) Gaps:59/239 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAPVIVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWF 66
            |...|:|...|....:|.||||||:...:::         |....|...|..:||...:|:|   
pombe    12 ACAEIIEGKDKVHNVVILMHGLGDSHKSFAN---------MAKNVPLPNTSYISLRGPYRLP--- 64

  Fly    67 DLKTLDIGGPE-----------DEPG-IQSARD------SVHGMIQKEISAGIPANRIVLGGFSQ 113
                ||...|.           |:.| :||..|      .:..:|...:|.||.::||...||.|
pombe    65 ----LDFENPGGNWMWGEDVHFDQNGELQSEADFSKSFTMISNLIGNLLSYGILSSRIFFFGFGQ 125

  Fly   114 GGALALYSA--LTYDQPLAGVVALSCWLPLHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQ-- 174
            |..:||||.  |:....|.|:.:....|||....|.             |..:.||  |.|.:  
pombe   126 GAMVALYSCYKLSTKYQLGGIFSFGGTLPLSITLPN-------------HPFHVPV--YLFEKRL 175

  Fly   175 -LSASLLKSFMKNVTFKTYSGLSHSSSDDEMDDVKDIISKWTQW 217
             .|.|..:......|||.:    |.:..:. ||..|:.|...:|
pombe   176 HCSCSEYEESRLRKTFKPF----HLTCWNR-DDKTDMPSSPREW 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 61/232 (26%)
SPAC9G1.08cNP_593563.1 Abhydrolase_2 14..229 CDD:280406 62/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10655
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.