DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and Lypla1

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_032892.1 Gene:Lypla1 / 18777 MGIID:1344588 Length:230 Species:Mus musculus


Alignment Length:219 Identity:118/219 - (53%)
Similarity:146/219 - (66%) Gaps:6/219 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAPV--IVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMP 63
            |:||:  :|.|..|.||.:||:||||||||||:.|.|.|:.|.:|.|||.||..||:||....||
Mouse     6 MSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMP 70

  Fly    64 SWFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQP 128
            ||||:..|.....|||.||:.|.::|..:|.:|:..|||:|||:||||||||||:||:|||..|.
Mouse    71 SWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQK 135

  Fly   129 LAGVVALSCWLPLHKQFPGAKVNS--DDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMK--NVTF 189
            ||||.||||||||...|....:||  .|:.:.|.|||.||:||..||.|:...||:.:.  ||||
Mouse   136 LAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTF 200

  Fly   190 KTYSGLSHSSSDDEMDDVKDIISK 213
            |.|.|:.|||...||.|||..|.|
Mouse   201 KIYEGMMHSSCQQEMMDVKHFIDK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 116/216 (54%)
Lypla1NP_032892.1 Abhydrolase_2 11..226 CDD:280406 115/214 (54%)
MhpC 24..>155 CDD:223669 77/130 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846980
Domainoid 1 1.000 235 1.000 Domainoid score I2351
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3392
Isobase 1 0.950 - 0.993157 Normalized mean entropy S960
OMA 1 1.010 - - QHG53978
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - otm44176
orthoMCL 1 0.900 - - OOG6_100696
Panther 1 1.100 - - LDO PTHR10655
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R75
SonicParanoid 1 1.000 - - X443
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.