DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and LYPLAL1

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001337557.1 Gene:LYPLAL1 / 127018 HGNCID:20440 Length:246 Species:Homo sapiens


Alignment Length:231 Identity:73/231 - (31%)
Similarity:107/231 - (46%) Gaps:32/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVEATVKQTATLIFMHGLGDTGHG---WSSALAAIRPPF--MKVICPTAPTQPVSLNAGFRMPS- 64
            ||....:.:|:|||:||.||:|.|   |...:......|  :|:|.||||.   |...|   || 
Human    13 IVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPP---SYTVG---PSF 71

  Fly    65 --------------WFDLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGG 115
                          |||...:....||....|......:..:|.:|:.:||..|||::||||.||
Human    72 ARSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGG 136

  Fly   116 ALALYSALTYDQPLAGVVALSCWLPLHKQFPGAKVNSDDV--PIFQAHGDYDPVVPYKFGQLSAS 178
            .:|::.|....|.:|||.|||.:|........|...|:.|  .:||.||..|.:|.:.:.:.:.|
Human   137 CMAIHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNS 201

  Fly   179 LLKSFMKNVTFKTYSGLSHSSSDDEMDDVKDIISKW 214
            :|||......|.::..:.|..|..|:    ||:..|
Human   202 MLKSLGVTTKFHSFPNVYHELSKTEL----DILKLW 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 72/229 (31%)
LYPLAL1NP_001337557.1 Abhydrolase 13..231 CDD:328752 72/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.