DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and LYPLA2

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_024308564.1 Gene:LYPLA2 / 11313 HGNCID:6738 Length:287 Species:Homo sapiens


Alignment Length:265 Identity:118/265 - (44%)
Similarity:152/265 - (57%) Gaps:52/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAPVIVEATV-----KQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF 60
            |:.|::.:|..     ::||.:||:||||||||.|:.||:.||.|.:|.|||.||..||:||...
Human    18 MSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM 82

  Fly    61 RMPSWFDLKTLDIGGPEDEPGIQSARDS------------------------------------- 88
            .|||||||..|....||||.||:.|.::                                     
Human    83 VMPSWFDLMGLSPDAPEDEAGIKKAAENSKTPAPPPHPPSPAPQESAGRFLSLAPLLGPLAASLY 147

  Fly    89 -------VHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQPLAGVVALSCWLPLHKQFP 146
                   |..:|:.|:..||||||||||||||||||:||:|||...||||:||||||||||:.||
Human   148 PLMPPPPVKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFP 212

  Fly   147 -GAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFM--KNVTFKTYSGLSHSSSDDEMDDVK 208
             .|..::.|:.|.|.||:.||:||.:||.|:|..|:|.:  ..|.||||.|:.|||...||..||
Human   213 QAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVK 277

  Fly   209 DIISK 213
            :.:.|
Human   278 EFLEK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 117/262 (45%)
LYPLA2XP_024308564.1 Abhydrolase_2 26..284 CDD:280406 116/257 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2372
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100964
Inparanoid 1 1.050 235 1.000 Inparanoid score I3404
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53978
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - otm42120
orthoMCL 1 0.900 - - OOG6_100696
Panther 1 1.100 - - LDO PTHR10655
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R75
SonicParanoid 1 1.000 - - X443
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.