Sequence 1: | NP_001261719.1 | Gene: | CG18815 / 59176 | FlyBaseID: | FBgn0042138 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024308564.1 | Gene: | LYPLA2 / 11313 | HGNCID: | 6738 | Length: | 287 | Species: | Homo sapiens |
Alignment Length: | 265 | Identity: | 118/265 - (44%) |
---|---|---|---|
Similarity: | 152/265 - (57%) | Gaps: | 52/265 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAAPVIVEATV-----KQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF 60
Fly 61 RMPSWFDLKTLDIGGPEDEPGIQSARDS------------------------------------- 88
Fly 89 -------VHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQPLAGVVALSCWLPLHKQFP 146
Fly 147 -GAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFM--KNVTFKTYSGLSHSSSDDEMDDVK 208
Fly 209 DIISK 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18815 | NP_001261719.1 | Abhydrolase_2 | 4..214 | CDD:280406 | 117/262 (45%) |
LYPLA2 | XP_024308564.1 | Abhydrolase_2 | 26..284 | CDD:280406 | 116/257 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 235 | 1.000 | Domainoid score | I2372 |
eggNOG | 1 | 0.900 | - | - | E1_COG0400 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H100964 | |
Inparanoid | 1 | 1.050 | 235 | 1.000 | Inparanoid score | I3404 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53978 | |
OrthoDB | 1 | 1.010 | - | - | D1373549at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000652 | |
OrthoInspector | 1 | 1.000 | - | - | otm42120 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_100696 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR10655 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R75 |
SonicParanoid | 1 | 1.000 | - | - | X443 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
14 | 13.910 |