DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18815 and LYPLA1

DIOPT Version :9

Sequence 1:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_006321.1 Gene:LYPLA1 / 10434 HGNCID:6737 Length:230 Species:Homo sapiens


Alignment Length:214 Identity:117/214 - (54%)
Similarity:143/214 - (66%) Gaps:4/214 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVIVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGFRMPSWFDL 68
            |.||.|..|.||.:||:||||||||||:.|.|.||...:|.|||.||.:||:||....||||||:
Human    11 PAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDI 75

  Fly    69 KTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQPLAGVV 133
            ..|.....|||.||:.|.:::..:|.:|:..|||:|||:||||||||||:||:|||..|.||||.
Human    76 IGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVT 140

  Fly   134 ALSCWLPLHKQFPGAKVN--SDDVPIFQAHGDYDPVVPYKFGQLSASLLKSFMK--NVTFKTYSG 194
            ||||||||...||...:.  :.|:.|.|.|||.||:||..||.|:...||:.:.  |||||||.|
Human   141 ALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEG 205

  Fly   195 LSHSSSDDEMDDVKDIISK 213
            :.|||...||.|||..|.|
Human   206 MMHSSCQQEMMDVKQFIDK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 117/214 (55%)
LYPLA1NP_006321.1 Abhydrolase_2 11..226 CDD:396693 117/214 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156567
Domainoid 1 1.000 235 1.000 Domainoid score I2372
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3404
Isobase 1 0.950 - 0.993157 Normalized mean entropy S960
OMA 1 1.010 - - QHG53978
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0000652
OrthoInspector 1 1.000 - - otm42120
orthoMCL 1 0.900 - - OOG6_100696
Panther 1 1.100 - - LDO PTHR10655
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R75
SonicParanoid 1 1.000 - - X443
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.