DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and AYR1

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_012142.3 Gene:AYR1 / 854682 SGDID:S000001386 Length:297 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:64/248 - (25%)
Similarity:100/248 - (40%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KNVVYLGGFGGIGKKCVQELLKKQIKGLAIFDLIVDDDLLAEWKKQHPDTEIFYQKMDITQKSDI 70
            |..|..|..||||.:..:||.:   .|..::......:.:|:...|..:..|...|:||::..:|
Yeast    10 KIAVVTGASGGIGYEVTKELAR---NGYLVYACARRLEPMAQLAIQFGNDSIKPYKLDISKPEEI 71

  Fly    71 DAAYKATAEKL--GHFDVVVNGSG------LLD--DRRIELTIQINLVGVINSTLTALEYMDKSK 125
            ..........|  |..|::.|.:|      .||  |..:|...::|:.|.||......|::.|:|
Yeast    72 VTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAAVEQCFKVNVFGHINMCRELSEFLIKAK 136

  Fly   126 GGRGGLIVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAM---ASPIHYAHSGVGFITICPGYTNT 187
                |.||...|:||:...|..:|||.||..:..:.|.:   ..|.:     |..|....|    
Yeast   137 ----GTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFN-----VRVINAITG---- 188

  Fly   188 GILKDIDKKTTFP------FYETR-----MRTVFSKVKGQTAEVCARNIVNAI 229
            |:..||..|...|      |.|.|     .:|:....|...|:..|:.:|..|
Yeast   189 GVATDIADKRPLPETSIYNFPEGREAFNSRKTMAKDNKPMPADAYAKQLVKDI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 64/248 (26%)
adh_short 6..196 CDD:278532 53/202 (26%)
AYR1NP_012142.3 17beta-HSD-like_SDR_c 10..256 CDD:187632 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.