DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and ABA2

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_175644.1 Gene:ABA2 / 841665 AraportID:AT1G52340 Length:285 Species:Arabidopsis thaliana


Alignment Length:246 Identity:65/246 - (26%)
Similarity:101/246 - (41%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEGKNVVYLGGFGGIGKKCVQELLKKQIKGLAIFDLIVDDDLLAEWKK-----QHPDTEIFYQKM 62
            |.||..:..||..|||:..|: |..|....:.|.||  .|||..|..|     :..:|..|... 
plant    18 LLGKVALITGGATGIGESIVR-LFHKHGAKVCIVDL--QDDLGGEVCKSLLRGESKETAFFIHG- 78

  Fly    63 DITQKSDIDAAYKATAEKLGHFDVVVNGSGLL-----DDR-----RIELTIQINLVGVINSTLTA 117
            |:..:.||..|.....:..|..|:::|.:||.     |.|     ..|:|..:|:.|...|...|
plant    79 DVRVEDDISNAVDFAVKNFGTLDILINNAGLCGAPCPDIRNYSLSEFEMTFDVNVKGAFLSMKHA 143

  Fly   118 LEYMDKSKGGRGGLIVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMASPIHYAHSGVGFITICP 182
            ...|...|.|.   ||::.||.|:........|..||..|...||::|:.:  ...|:....:.|
plant   144 ARVMIPEKKGS---IVSLCSVGGVVGGVGPHSYVGSKHAVLGLTRSVAAEL--GQHGIRVNCVSP 203

  Fly   183 GYTNTGI-LKDI--DKKTTFPFYETR-MRTVFSKVKGQTAEVCARNIVNAI 229
            ....|.: |..:  :::|...|...| .....:.:||  .|:...::.||:
plant   204 YAVATKLALAHLPEEERTEDAFVGFRNFAAANANLKG--VELTVDDVANAV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 63/243 (26%)
adh_short 6..196 CDD:278532 55/207 (27%)
ABA2NP_175644.1 PLN02253 3..285 CDD:177895 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.