DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and NQR

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001185182.1 Gene:NQR / 841391 AraportID:AT1G49670 Length:652 Species:Arabidopsis thaliana


Alignment Length:217 Identity:61/217 - (28%)
Similarity:101/217 - (46%) Gaps:40/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKNVVYLGGFGGIGKKCVQELLKKQIKGLAIFDLIVDDDLLAEWKKQHPDTEI------FYQ--- 60
            |.:.:..||..|||:.....|.:|     .:|..:.|   .:|.|.|...:.:      |:|   
plant     6 GLSALVTGGASGIGRALCLALAEK-----GVFVTVAD---FSEEKGQETTSLVREANAKFHQGLS 62

  Fly    61 -------KMDITQKSDIDAAYKATAEKLGHFDVVVNGSGLLDDRRIEL-----------TIQINL 107
                   |.|:|.:.|:.||:.......|..|:.:|.:|:....|.:.           ||.::|
plant    63 FPSAIFVKCDVTNRGDLLAAFDKHLATFGTLDICINNAGISTPLRFDKDDTDGSKSWKHTINVDL 127

  Fly   108 VGVINSTLTALEYMDKSKGGRGGLIVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMASPIHYAH 172
            :.|:..|..|::.| |:| .:.|:|:|:.|.|||.|.|:..||:.||.||..|||::|   :|..
plant   128 IAVVEGTQLAIKAM-KAK-QKPGVIINMGSAAGLYPMPVDPIYAASKAGVVLFTRSLA---YYRR 187

  Fly   173 SGVGFITICPGYTNTGILKDID 194
            .|:....:||.:..|.:.:.||
plant   188 QGIRINVLCPEFIKTDLAEAID 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 60/216 (28%)
adh_short 6..196 CDD:278532 60/216 (28%)
NQRNP_001185182.1 ADH_SDR_c_like 9..254 CDD:187584 60/214 (28%)
adh_short 9..210 CDD:278532 60/214 (28%)
CurA 285..639 CDD:225041
Mgc45594_like 286..640 CDD:176212
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2961
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.