DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and Hsd17b14

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001178040.1 Gene:Hsd17b14 / 691018 RGDID:1588673 Length:270 Species:Rattus norvegicus


Alignment Length:266 Identity:76/266 - (28%)
Similarity:111/266 - (41%) Gaps:49/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKNVVYLGGFGGIGKKCVQELL----------KKQIKGLAIFDLIVDDDLLAEWKKQHPDTEIFY 59
            ||.||..||..|||...|:..:          |.:..|.|     |:.:||.         .:|.
  Rat     9 GKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDEAGGRA-----VEQELLG---------TVFI 59

  Fly    60 QKMDITQKSDIDAAYKATAEKLGHFDVVVNGSGLLDDRRI-ELT--------IQINLVGVINSTL 115
            .. |:||:.|:......|..:.||.|.|||.:|.....:: |.|        ::.||:|......
  Rat    60 PG-DVTQEGDLQTLISETVSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEENLLGAYTLIK 123

  Fly   116 TALEYMDKSKGGRGGLIVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMASPIHYAHSGVGFITI 180
            .||.::.||||.    |:||||:.|.........|..:|..||..|:|:|  :..:..||....|
  Rat   124 LALPHLRKSKGN----IINISSLVGAIGQSQALTYVATKGAVTAMTKALA--LDESRYGVRVNCI 182

  Fly   181 CPGYTNTGILKDIDKKTTFP---FYETRMRTVFSKVKGQTAEVCARNIVNAIE-TAKNGAVLML- 240
            .||...|.:.:::...|:.|   ..|..:.....:: ||.|||.|..:..|.| |...|..|.: 
  Rat   183 SPGNIWTPLWQELAAATSDPRATILEGTLAQPLGRM-GQPAEVGAAAVFLASEATFCTGLELFMT 246

  Fly   241 ---ELG 243
               |||
  Rat   247 GGAELG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 75/265 (28%)
adh_short 6..196 CDD:278532 58/208 (28%)
Hsd17b14NP_001178040.1 NADB_Rossmann 1..256 CDD:419666 76/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.