DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and HSD17B14

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens


Alignment Length:286 Identity:80/286 - (27%)
Similarity:115/286 - (40%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKNVVYLGGFGGIGKKCVQELLKKQIKGLAIFDLIVDDDLLAEWKKQHPDTEIFYQKMDITQKSD 69
            ||.||..||..|||...|:..:....: :.|.|   .|:......:|.....:|. ..|:||:.|
Human     9 GKVVVVTGGGRGIGAGIVRAFVNSGAR-VVICD---KDESGGRALEQELPGAVFI-LCDVTQEDD 68

  Fly    70 IDAAYKATAEKLGHFDVVVNGSG-LLDDRRIELT--------IQINLVGVINSTLTALEYMDKSK 125
            :......|..:.|..|.|||.:| ....:|.|.|        :::||:|....|..||.|:.||:
Human    69 VKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQ 133

  Fly   126 GGRGGLIVNISSVAG----LQPTPLMAIYSTSKTGVTTFTRAMA---SPIHYAHSGVGFITICPG 183
            |.    ::||||:.|    .|..|    |..:|..||..|:|:|   ||.     ||....|.||
Human   134 GN----VINISSLVGAIGQAQAVP----YVATKGAVTAMTKALALDESPY-----GVRVNCISPG 185

  Fly   184 YTNTGILKDI-----DKKTTFPFYETRMRTVFSKVKGQTAEVCA--------RNIVNAIETAKNG 235
            ...|.:.:::     |.:.|  ..|..:.....:: ||.|||.|        .|....||....|
Human   186 NIWTPLWEELAALMPDPRAT--IREGMLAQPLGRM-GQPAEVGAAAVFLASEANFCTGIELLVTG 247

  Fly   236 AVLMLELG---------EIHELDIPN 252
            ..   |||         .:...|||:
Human   248 GA---ELGYGCKASRSTPVDAPDIPS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 76/279 (27%)
adh_short 6..196 CDD:278532 61/210 (29%)
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 77/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.