DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and hsd17b14

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001003521.1 Gene:hsd17b14 / 445127 ZFINID:ZDB-GENE-040801-24 Length:271 Species:Danio rerio


Alignment Length:257 Identity:57/257 - (22%)
Similarity:98/257 - (38%) Gaps:55/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EGKNVVYLGGFGGIGKKCVQELLKKQIKGLAIF-----DLIVDDDLLAEWKKQHPDTEIFYQKMD 63
            :.|.|:..||..|||:..|:..::...|  .:|     ::.....|.:...|:.|.:..|. ..|
Zfish     8 QNKVVIVTGGTRGIGRGIVKTFVQNGSK--VVFCAPQTEMSAGQSLESVLNKEGPGSCKFV-SCD 69

  Fly    64 ITQKSDIDAAYKATAEKLGHFDVVVNGSG------LLDD---RRIELTIQINLVGVINSTLTALE 119
            :.::.||......|.|..|..|.:||..|      ..|:   ...:..:.:||:....::..||.
Zfish    70 MREEEDIKQLINVTVESFGQIDCLVNNVGWHPPHKTTDETSGEEFKDLLNLNLISFFLASKYALP 134

  Fly   120 YMDKSKGGRGGLIVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMASPIHYAHSGVGFITICPGY 184
            |:.|::|.    |:|:||:.........|.|..:|..:|..|:|||                   
Zfish   135 YLRKTQGN----IINLSSLVASIGQKDAAPYVATKGAITAMTKAMA------------------- 176

  Fly   185 TNTGILKDIDKKTTFPFYETRMRTVF-SKVKGQTAEVCARNIVNAIETAKNG--AVLMLELG 243
                    :|:..    |:.|:..:. |.:.....|..|.|..:...|.|.|  |.|:..:|
Zfish   177 --------VDESR----YQVRVNCISPSNIMTPLWEELAANTEDTAATIKGGEDAQLIGRMG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 57/255 (22%)
adh_short 6..196 CDD:278532 45/203 (22%)
hsd17b14NP_001003521.1 RDH_SDR_c 1..263 CDD:187638 57/257 (22%)
adh_short 26..205 CDD:278532 43/216 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.