DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and Adh

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001027266.1 Gene:Adh / 3771877 FlyBaseID:FBgn0000055 Length:256 Species:Drosophila melanogaster


Alignment Length:267 Identity:90/267 - (33%)
Similarity:136/267 - (50%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEGKNVVYLGGFGGIGKKCVQELLKKQIKGLAIFDLIVDDDLLAEWKKQHPDTEIFYQKMDITQK 67
            |..|||:::.|.||||....:||||:.:|.|.|.|.|.:...:||.|..:|...:.:...|:|..
  Fly     5 LTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVP 69

  Fly    68 -SDIDAAYKATAEKLGHFDVVVNGSGLLDDRRIELTIQINLVGVINSTLTALEYMDKSKGGRGGL 131
             ::.....|....:|...||::||:|:|||.:||.||.:|..|::|:|...|::.||.|||.||:
  Fly    70 IAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGI 134

  Fly   132 IVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMA--SPIHYAHSGVGFITICPGYTNTGILKDID 194
            |.||.||.|......:.:||.:|..|..||.::|  :||    :||...|:.||.|.|.::...:
  Fly   135 ICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPI----TGVTAYTVNPGITRTTLVHTFN 195

  Fly   195 KKTTFPFYETRMRTVFSKVKGQTAE-----------VCARNIVNAIETAKNGAVLMLELGEIHEL 248
            .              :..|:.|.||           .||.|.|.|||..:|||:..|:||.:..:
  Fly   196 S--------------WLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAI 246

  Fly   249 DIPNLWN 255
            .....|:
  Fly   247 QWTKHWD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 88/255 (35%)
adh_short 6..196 CDD:278532 71/192 (37%)
AdhNP_001027266.1 ADH_SDR_c_like 8..247 CDD:187584 88/256 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455190
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Homologene 1 1.000 - - H134459
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008550
OrthoInspector 1 1.000 - - otm44427
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.