DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and Fbp2

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster


Alignment Length:253 Identity:87/253 - (34%)
Similarity:158/253 - (62%) Gaps:1/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLEGKNVVYLGGFGGIGKKCVQELLKKQIKGLAIFDLIVDDDLLAEWKKQHPDTEIFYQKMDITQ 66
            |..||||||:|.|.|||.:.:.:|::|.||.:.|...:.:..::.:.:..:|..::.:.:|::.:
  Fly     3 DWTGKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRMENVKMMKKLQAINPSVKVVFMQMNLME 67

  Fly    67 KSDIDAAYKATAEKLGHFDVVVNGSGLLDDRRIELTIQINLVGVINSTLTALEYMDKSKGGRGGL 131
            |..|:.|.|...:.:||.||::||.|:|.|:.:|.|:.:||.|:|.||:.|:.||||::.|.||:
  Fly    68 KMSIEQAMKKMGQMMGHIDVMINGEGVLLDKDVETTMGMNLTGMIQSTMMAMPYMDKTQMGMGGM 132

  Fly   132 IVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMASPIHYAHSGVGFITICPGYTNTGILKDIDKK 196
            :||:|||.||:|.|..::|:.:..|:..|||:|...:.|..:||.|:.:|||.||:.::.::...
  Fly   133 VVNMSSVYGLEPAPAFSVYAAAMHGILGFTRSMGDKMIYQKTGVMFMAMCPGLTNSEMIMNLRDN 197

  Fly   197 TTFPFYETRMRTVFSKVKGQTAEVCARNIVNAIETAKNGAVLMLELGEIHELDIPNLW 254
            .|:...|:.:..:.| .|.|..|..|..:::|:|..|||::.::.:|::.|:.....|
  Fly   198 VTWHHSESMVEAIES-AKRQMPEEAAMQMIHAMEMMKNGSMWIVSMGQLKEVTPTMHW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 83/241 (34%)
adh_short 6..196 CDD:278532 70/189 (37%)
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 84/242 (35%)
adh_short 7..198 CDD:278532 70/190 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455193
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Homologene 1 1.000 - - H134459
Inparanoid 1 1.050 136 1.000 Inparanoid score I4534
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 1 1.000 - - FOG0008550
OrthoInspector 1 1.000 - - mtm6395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2961
1110.900

Return to query results.
Submit another query.