DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and Dhrs4

DIOPT Version :10

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001033027.2 Gene:Dhrs4 / 28200 MGIID:90169 Length:279 Species:Mus musculus


Alignment Length:221 Identity:48/221 - (21%)
Similarity:80/221 - (36%) Gaps:73/221 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEGKNVVYLGGFGGIGK-----KCVQELLKKQIKGLAIFDLIVDDDLLAEWKKQHPDTEIFYQKM 62
            |:|:.:...|....:||     |.:...||:. :|:   |::|.:..:         ...|...|
Mouse    77 LQGEGLSVTGIVCHVGKAEDREKLITTALKRH-QGI---DILVSNAAV---------NPFFGNLM 128

  Fly    63 DITQKSDIDAAYKATAEKLGHFDVVVNGSGLLDDRRIELTIQINLVGVINSTLTALEYM----DK 123
            |:|::.               :|.|::                     ||.|.||:...    :.
Mouse   129 DVTEEV---------------WDKVLS---------------------INVTATAMMIKAVVPEM 157

  Fly   124 SKGGRGGLIVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMASPIHYAHSGVGFITICPGYTNTG 188
            .|.| ||.:|.:.||||....|.:..|:.|||.:...|:..|:.:  |...:....:.||..   
Mouse   158 EKRG-GGSVVIVGSVAGFTRFPSLGPYNVSKTALLGLTKNFAAEL--APKNIRVNCLAPGLI--- 216

  Fly   189 ILKDIDKKTTFP--FYETRMRTVFSK 212
                   ||.|.  .:|.:.|..|.|
Mouse   217 -------KTRFSSVLWEEKAREDFIK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 Rossmann-fold NAD(P)(+)-binding proteins 6..248 CDD:473865 46/218 (21%)
Dhrs4NP_001033027.2 CR_SDR_c 24..279 CDD:187641 48/221 (22%)
Peroxisomal targeting signal 277..279
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.